<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH-HC14 HolgHC14 Equatorial Guinea 1998 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ RTV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15L, L19P, K20I, E21K, E35D, M36I, R41K, H69K, L89M  
>HolgHC14| codons 9-97
PLVTVRLGGQPIKALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQILIEICG
KKAIGTVLVGPTPVNIIGRNMLTQIGCTL

References
Author Title Citation
Holguin, A Protease gene analysis of HIV Type 1 non-B subtypes in Spain. ARHR, 2000
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005