<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH-HC4 HolgHC4 Argentina 1998 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I13V, I15V, E35D, M36T, R41K, R57K, Q61N, I64V, N98I  
>HolgHC4| codons 9-99
PLVIVKVGGQLKEALLDTGADDTVLEDTNLPGKWKPKMIGGIGGFIKVKQYDNILVEICG
HKAIGTVLVGPTPVNIIGRNLLTQIGCTLIF

References
Author Title Citation
Holguin, A Protease gene analysis of HIV Type 1 non-B subtypes in Spain. ARHR, 2000