<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI NA
2 PI NA
3 ABC+D4T+EFV+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210W, T215Y   K101E, K103N, G190S, M230L K238T D86E, K102X, V118I, K122P, A158S, Q174X, D177E, R211K, F214L, H221Y  
>Huang-Pt3| codons 1-270
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLEXNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKXNPEIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLWKWGLYTPDKKYQKEPPFLWLGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQI

References
Author Title Citation
Huang, W A novel HIV-1 RT mutation (M230L) confers NNRTI resistance and dose-dependent stimulation of replication. Antivir Ther, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005