<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Huang-Pt3 Huang-Pt3 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 PI NA
3 ABC+D4T+EFV+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210W, T215Y   K101E, K103N, G190S, M230L K238T D86E, K102X, V118I, K122P, A158S, Q174X, D177E, R211K, F214L, H221Y  
>Huang-Pt3| codons 1-270
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLEXNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKXNPEIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLWKWGLYTPDKKYQKEPPFLWLGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQI

References
Author Title Citation
Huang, W A novel HIV-1 RT mutation (M230L) confers NNRTI resistance and dose-dependent stimulation of replication. Antivir Ther, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005