<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DB_SI6645-00 SI6645-00 Slovenia 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R57K, L63T, H69K, L89M  
>SI6645-00| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYDQIT
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, V60I, D121H, K122E, D123DG, I135T, K173L, Q174K, D177E, V179I, T200A, Q207A, R211S, V245L  
>SI6645-00| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRLKNPEIIIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPILLP

References
Author Title Citation
Babic, DZ Prevalence of antiretroviral drug resistance mutations and HIV-1 non-B subtypes in newly diagnosed drug-naive patients in Slovenia, 2000-2004. Virus Res, 2006