<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DB_SI7658-01 SI7658-01 Slovenia 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, E35D, M36I, N37D, R41K, K43R, L63H, I64L, H69K, K70R, L89M  
>SI7658-01| codons 4-99
TLWQRPLVTVRIEGQLIEALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYDQIH
LEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, S68SG, K102Q, S162A, K173T, D177E, T200A, E204K, Q207E, R211K, V245Q  
>SI7658-01| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Babic, DZ Prevalence of antiretroviral drug resistance mutations and HIV-1 non-B subtypes in newly diagnosed drug-naive patients in Slovenia, 2000-2004. Virus Res, 2006