<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A12589 A 12589 M42 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 200
2 3TC+AZT+NVP 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K101E, Y181C A98G V60VI, S68SG, K122E, D123S, I135T, E138EQ, K173I, Q174K, D177E, I178L, T200L, Q207A, R211S, V245E  
>A 12589 M42| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRIKNPELVICQYVDDLYVGSDLEIGQHRLKIEELRAHLLSWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, H69K, L89M  
>A 12589 M42| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010