<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13530 A 13530 M24 Cambodia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 13
2 3TC+D4T+EFV 61
3 3TC+AZT+EFV 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75M K103N A98G, P225H T39E, K122E, D123GS, S162C, K173R, Q174K, D177E, I178L, V179I, T200I, Q207A, R211S, V245E I135ILPT
>A 13530 M24| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRRKNPELIIYQYVDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, N37NS, R41K, L63C, H69K, V82I, L89M  
>A 13530 M24| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQIC
IEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010