<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13530 A13530M18 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 13
2 3TC+D4T+EFV 61
3 3TC+AZT+EFV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K70KT K103N A98G T39E, K122E, D123S, S162C, K173IR, Q174K, D177E, I178L, V179I, T200I, Q207A, R211S, K238R, V245E I135ILPT
>A13530M18| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKDSTTWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRRKNPELIIYQYVDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, L63C, H69K, V82I, L89M  
>A13530M18| codons 4-98
TLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIC
IEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLN

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010