<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A12500 A 12500 M30 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 35
2 3TC+AZT+NVP 4
3 3TC+NVP+TDF 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V A62AV, K219KE Y181C, G190A   S68SN, K101R, K122E, D123S, K173I, Q174K, D177E, I178M, G196R, T200E, Q207G, R211S, K238R, V245E  
>A 12500 M30| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRIKNPEMVICQYVDDLYVASDLEIRQHREKIEELRGHLLSWGFTTP
DEKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K45R, L63P, H69K, K70R, L89M  
>A 12500 M30| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYDQIP
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010