<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A14091 A14091M18 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, E35ED, M36I, R41K, L63A, H69K, L89LM, I93IL  
>A14091M18| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIA
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R D67DG, K219KE V106A, Y181C   T39K, V60I, S68G, K122E, D123N, T165I, K173IR, Q174K, D177E, T200I, I202V, Q207A, R211S, H221Y, K238R, V245E P157A
>A14091M18| codons 38-247
CKEMEKEGKISKIGPENPYNTPIFAIKRKGGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSA
AIFQSSMIKILEPFRRKNPEIVICQYMDDLYVGSDLEIGQHRIKVEELRAHLLSWGFTTP
DEKYQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010