<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A14091 A 14091 RS Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, E35ED, M36I, R41K, L63A, H69K, L89LM, I93IL  
>A 14091 RS| codons 5-99
LWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIAI
EICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   V106A, Y181C   T39K, V60I, S68SG, K122E, D123N, T165I, K173I, Q174K, D177E, T200I, I202V, Q207A, R211S, H221Y, K238R, V245E P157A
>A 14091 RS| codons 38-247
CKEMEKEGKISKIGPENPYNTPIFAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSA
AIFQSSMIKILEPFRIKNPEIVICQYMDDLYVGSDLEIGQHRIKVEELRAHLLSWGFTTP
DKKYQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010