<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A14515 A 14515 RS Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, Q151M, M184V V75VI, F116Y G190S P225PH K49R, V60I, K122E, D123S, T165IL, G196E, Q197K, R211K, V245K  
>A 14515 RS| codons 38-247
CTEMEKEGKISRIGPENPYNTPIFAIKKKNSDKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMLKILEPFRKQNPDIVIYQYVDDLYVSSDLEIEKHRTKIEELRQHLLKWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, M36I, R41K, H69K, I72M, L89M  
>A 14515 RS| codons 5-99
LWQRPLVTVKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILI
EICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010