<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13883 A 13883 RS Cambodia 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H S68G, T69TI, K102Q, D123E, K166R, I178L, G196E, T200A, Q207H, R211K, V245M  
>A 13883 RS| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGIKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDLVIYQYVDDLYVGSDLEIEQHRAKIEELRHHLLKWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20KR, L63P, V77I, I93L  
>A 13883 RS| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010