<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13458 A13458M30 Cambodia 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS   Y181C   K49R, S68G, K101KR, I135V, S162T, K173T, Q174R, D177E, I178M, Q207ADE, L210LM, H221Y, P243T, V245Q  
>A13458M30| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQTSMTKILEPFRTRNPEMVICQYVDDLYVGSDLEIGQHRTKIEELREHLMRWGFSTP
DKKYQKEPPFLWMGYELHPDKWTVQTIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, N37T, R41K, K43R, L63P, H69K, K70KR, L89M  
>A13458M30| codons 4-99
TLWQRPLVTVKIGGQLIEALLDTGADDTVLEEITLPGKWRPKMIGGIGGFIKVRQYDQIP
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010