<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13458 A 13458 M30 Cambodia 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, N37T, R41K, K43R, L63P, H69K, K70KR, L89M  
>A 13458 M30| codons 4-99
TLWQRPLVTVKIGGQLIEALLDTGADDTVLEEITLPGKWRPKMIGGIGGFIKVRQYDQIP
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS   Y181C   K49R, S68G, K101KR, I135V, S162T, K173T, Q174R, D177E, I178M, Q207ADE, L210LM, H221Y, P243T, V245Q  
>A 13458 M30| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQTSMTKILEPFRTRNPEMVICQYVDDLYVGSDLEIGQHRTKIEELREHLMRWGFSTP
DKKYQKEPPFLWMGYELHPDKWTVQTIQLP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010