<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A15239 A 15239 M18 Cambodia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 4
2 3TC+D4T+EFV 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, L74LV, M184V   K103N, G190A   T39K, K43Q, V106VI, K122E, D123NS, S162SC, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E  
>A 15239 M18| codons 38-247
CKEMEQEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSITVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRIKNPEIVIYQYVDDLYVASDLEIGQHRTKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, M36I, R41K, L63C, H69K, K70KR, L89LM  
>A 15239 M18| codons 4-99
TLWQRPLVTIKIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIC
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010