<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13412 A 13412 M24 Cambodia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20I, E35DN, M36I, R41K, H69K, V77I, L89M K70GR
>A 13412 M24| codons 4-99
TLWQRPIVTVKIEGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219N Y181C   T39E, S68K, V90I, K122E, D123S, I135R, S162C, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E  
>A 13412 M24| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKDKTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRIKNPEIVICQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTP
DNKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010