<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TS G190GA   T39K, E42EK, K43E, G45GE, K122KE, D123S, S163T, K173IT, Q174K, D177E, I178M, T200IM, Q207E, K238R, V245E  
>A 13524 M24| codons 38-247
CKEMKEEEKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSTMTKILEPFRTKNPEMVIYQYMDDLYVASDLEIGQHRMKIEELREHLLRWGFSTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, K20R, E35D, M36I, N37D, R41K, K43KR, L63PS, H69K, K70KR, L89M, I93L  
>A 13524 M24| codons 4-99
TLWQRPLVTIRIGGQLREALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYDQIS
IEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010