<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A13524 A 13524 M12 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39K, K43E, K122E, D123S, S163T, K173I, Q174K, D177E, I178M, T200I, Q207E, R211RK, K238R, V245E  
>A 13524 M12| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSTMTKILEPFRIKNPEMVIYQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, K20R, E35D, M36I, N37D, R41K, L63P, H69K, K70KR, L89M, I93L G94GDNS
>A 13524 M12| codons 4-99
TLWQRPLVTIRIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKRAIGTVLVGPTPVNIIGRNMLTQLSCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010