<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A15334 A 15334 M6 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188YC, G190GA V179D T39KN, K43E, V60VI, V111I, D121H, K122E, D123S, S163T, K166R, K173I, Q174K, D177E, T200A, E203D, Q207A, R211S, V245E  
>A 15334 M6| codons 38-247
CNEMEEEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDIGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSTMTRILEPFRIKNPEIDIYQYMDDLCVASDLEIGQHRAKIDELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, M36IT, R41K, L63P, H69K, K70R, I72IV  
>A 15334 M6| codons 4-99
TLWQRPLVTVKVGGQLKEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKRAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010