<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A15056 A 15056 M12 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, M36I, R41K, L63S, H69K  
>A 15056 M12| codons 4-99
TLWQRPVVTVKIEGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIS
IEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75IM Y181C   T39N, K102Q, K122E, D123S, I132IL, I142V, S162C, K173I, Q174K, D177E, V189VI, Q207A, R211S, L228LR, K238R, V245E N54NS
>A 15056 M12| codons 38-247
CNEMEKEGKISKIGPESPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDESFRKYTAFTLPSINNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRIKNPEIVICQYVDDLYIGSDLEIGQHRTKIEELRAHLLSWGFTTP
DKKHQKEPPFRWMGYELHPDRWTVQPIELP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010