<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A14683 A14683M6 Cambodia 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K20R, E35D, M36I, R41K, Q61E, L63P, H69K, L89M  
>A14683M6| codons 4-99
TLWQRPVVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDEIP
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, M230L   T39K, K43N, S68G, T69A, W88C, V90I, V106I, K122E, D123N, I135T, S162A, K173I, Q174K, D177E, I178M, T200A, E203D, Q207A, R211S, V245E  
>A14683M6| codons 38-247
CKEMENEGKISKIGPENPYNTPVFAIKKKDGAKWRKLVDFRELNKRTQDFCEIQLGIPHP
AGLKKNKSITVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRIKNPEMVIYQYVDDLYVGSDLEIGQHRAKIDELRAHLLSWGFTTP
DKKHQKEPPFLWLGYELHPDKWTVQPIELP

References
Author Title Citation
Zolfo, M Genotypic impact of prolonged detectable HIV type 1 RNA viral load after HAART failure in a CRF01_AE-infected cohort. ARHR, 2010