Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SA-090941d | SA-090941d | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 52 |
| 2 | AZT+SQV | 20 |
| 3 | AZT+D4T+SQV | 2 |
| 4 | AZT+DDI+SQV | 11 |
| 5 | AZT+SQV | 5 |
| 6 | 3TC+AZT+SQV | 29 |
| 7 | AZT+SQV | 22 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I84V, L90M | L10I, I13V, I15V, K20M, Q61QE, I62V, L63P, A71T |
| >SA-090941d| codons 1-99 PQITLWQRPIVTVKVGGQLMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD EVPIEICGHKTIGTVLVGPTPVNVIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Sevin, AD | Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
