<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA-090943l SA-090943l U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 363
2 None 5
3 DDC+SQV 89
4 3TC+D4T+SQV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M N88D I15V, M36I, N37S, R41K, K45R, I62V, L63P, A71T, I93L  
>SA-090943l| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEISLPGKWKPRMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Sevin, AD Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005