<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA-090949k SA-090949k U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 None 226
3 DDC+ SQV 93
4 3TC+ D4T+ SQV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, K14R, G16E, E35D, N37A, L63Q, I64V  
>SA-090949k| codons 1-99
PQITLWQRPLVSVRIEGQLKEALLDTGADDTVLEDMALPGRWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sevin, AD Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005