Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SA-090951c | SA-090951c | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 74 |
| 2 | AZT+SQV | 91 |
| 3 | 3TC+AZT+SQV | 8 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L33F | I13IV, G16E, N37Q, P39S, R57K, I62V, L63S, I64V |
| >SA-090951c| codons 1-99 PQITLWQRPLVTVKIEGQLKEALLDTGADDTVFEEMQLSGRWKPKMIGGIGGFIKVKQYD QVSVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Sevin, AD | Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |