<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA-110522e SA-110522e U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 16
2 AZT+DDI 166
3 AZT+DDC 56
4 AZT+DDC+SQV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S I15V, E35D, M36I, N37A, I62V, L63P, I85V D60DH
>SA-110522e| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDIALPGRWKPKMIGGIGGFIKVRQYH
QVPIEICGHKAISTVLVGPTPVNIVGRNLMTQIGCTLNF

References
Author Title Citation
Sevin, AD Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005