Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SA-172018l | SA-172018l | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | SQV | 34 |
| 2 | AZT+SQV | 52 |
| 3 | 3TC+AZT+SQV | 20 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| Q58QE | N37DH, L63S, E65ED, A71T, I72T | G52GV, Q61QP |
| >SA-172018l| codons 1-99 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGVFIKVREYD PISIDICGHKTTGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Sevin, AD | Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |