<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA-172021b SA-172021b U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 60
2 DDC+SQV 66
3 SQV 8
4 D4T+SQV 3
5 3TC+D4T+SQV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A, L90M   L10LI, M46X, I62IV, L63P, I64V, T74TS, V77VI  
>SA-172021b| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKXIVGIGGFIKVRQYD
QVPVEICGHKAIGSVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Sevin, AD Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005