Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SA-172021b | SA-172021b | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 60 |
| 2 | DDC+SQV | 66 |
| 3 | SQV | 8 |
| 4 | D4T+SQV | 3 |
| 5 | 3TC+D4T+SQV | 18 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, V82A, L90M | L10LI, M46X, I62IV, L63P, I64V, T74TS, V77VI |
| >SA-172021b| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKXIVGIGGFIKVRQYD QVPVEICGHKAIGSVLIGPTPANIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Sevin, AD | Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
