<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA-231025c SA-231025c U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 76
2 AZT+DDI 28
3 AZT 2
4 AZT+DDC 58
5 AZT+DDC+SQV 19
6 DDC+SQV 63
7 3TC+DDC+SQV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82C, L90M   L10I, L19IM, N37S, L63P, H69Q, A71V, I72IT, I93M  
>SA-231025c| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGQKVTGTVLVGPTPCNIIGRNLMTQMGCTLNF

References
Author Title Citation
Sevin, AD Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005