Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SA-231025c | SA-231025c | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 76 |
| 2 | AZT+DDI | 28 |
| 3 | AZT | 2 |
| 4 | AZT+DDC | 58 |
| 5 | AZT+DDC+SQV | 19 |
| 6 | DDC+SQV | 63 |
| 7 | 3TC+DDC+SQV | 39 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54V, V82C, L90M | L10I, L19IM, N37S, L63P, H69Q, A71V, I72IT, I93M |
| >SA-231025c| codons 1-99 PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIVGIGGFVKVRQYD QIPIEICGQKVTGTVLVGPTPCNIIGRNLMTQMGCTLNF |
References
| Author | Title | Citation |
| Sevin, AD | Methods for investigating the relationship between drug-susceptibility phenotype and HIV-1 genotype with applications to ACTG 333. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |