<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, M36I, R41K, K45R, R57K, H69Q, L89M  
>S5pol| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVFEEINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39I, V60I, I135T, T165I, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, F214L, E248D, T286A, E291D, I293V, P294T, G335D, M357R, G359S, T369A, A371V, I375V, A376V, T377M, K390R, A400T, T403M, E404D  
>S5pol| codons 1-411
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICIEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARRRSA
HTNDVKQLAEVVQKVVMESIVIWGKTPKFRLPIQKETWETWWMDYWQATWI

References
Author Title Citation
Mosha, F Prevalence of genotypic resistance to antiretroviral drugs in treatment-naive youths infected with diverse HIV type 1 subtypes and recombinant forms in Dar es Salaam, Tanzania. ARHR, 2010