<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, E35D, M36I, R41K, D60E, L63T, I64L, H69K, L89M, I93L  
>086u| codons 10-99
IVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYEQITLEICGK
KAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, K32R, V35I, V60I, I142T, Q174R, D177E, I178M, T200AV, Q207E, R211K, V245E, E248D, D250E Q151QH
>086u| codons 1-250
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIRALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGTRYQYNVLPHGWKGSPAIFQSSMTKILEPFRKRNPEMVI
YQYMDDLYVGSDLEIGQHRVKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKE

References
Author Title Citation
Avi, R Emerging transmitted drug resistance in treatment-naive human immunodeficiency virus-1 CRF06_cpx-infected patients in Estonia. Scand J Infect Dis, 2011