<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M K70W, K219R K103N, Y181C, G190A   T39K, K43E, V60I, S68G, T69K, V90I, K122E, D123N, I135L, R172K, Q174K, D177E, I178M, T200A, Q207A, R211S, K238I P157A
>25N0099| codons 38-247
CKEMEEEGKISKIGPENPYNTPIFAIKRKDGKWWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSA
AIFQSSMTKILEPFKKKNPEMVICQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTP
DRKHQKEPPFLWMGYELHPDIWTVQPIVLP

References
Author Title Citation
Manosuthi, W Patients infected with HIV type 1 subtype CRF01_AE and failing first-line nevirapine- and efavirenz-based regimens demonstrate considerable cross-resistance to etravirine. ARHR, 2010