<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
25-0275 25-0275 Thailand 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V V75M Y181C F227L K43E, S68G, K101Q, V106I, K122E, D123S, K173T, Q174K, N175K, I178M, Q207A, R211S, H221Y, K238R, V245E  
>25-0275| codons 40-247
EMEEEGKISKIGPENPYNTPVFAIKKKDGTRWRKLMDFRELNKRTQDFWEVQLGIPHPAG
LQKKKSITVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRTKKPDMVICQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDK
KYQKEPPLLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Manosuthi, W Patients infected with HIV type 1 subtype CRF01_AE and failing first-line nevirapine- and efavirenz-based regimens demonstrate considerable cross-resistance to etravirine. ARHR, 2010