<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
25-0671 25-0671 Thailand 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   G190A   T39K, K43E, D121H, K122E, D123S, I135T, K173V, Q174K, D177E, T200A, Q207A, R211S, K238R, V245E  
>25-0671| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRVKNPEIVIYQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Manosuthi, W Patients infected with HIV type 1 subtype CRF01_AE and failing first-line nevirapine- and efavirenz-based regimens demonstrate considerable cross-resistance to etravirine. ARHR, 2010