<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16233D_05_P1 16233 Uganda 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   E6D, K32R, V35T, K49R, V60I, K122E, D123S, I135T, T139R, K173S, Q174K, Q207A, R211K  
>16233| codons 1-242
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIRALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010