<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT1524_05_P1 1524 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, L63P, I64V, H69Y, I72E, V77I  
>1524| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGYKAEGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   V35T, T39R, K43E, K49R, V60I, K166R, E169D, D177E, T200I, Q207E, R211K E233V, L234LF, P236R
>1524| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICREMEEEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRKQNPEIVI
YQYVDDLYVASDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYVFHRDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010