<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT4014_05_P1 4014 Uganda 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E44D, K49R, I50V, V60I, K104Q, D121H, K122E, D123T, I135T, I142V, E169D, K173A, Q174K, D177E, V179I, G196E, T200L, Q207A  
>4014| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKDGKISRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKQSVTVLDVGDAYFSVPL
HETFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIII
YQYVDDLYVGSDLEIEQHRLKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>4014| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010