<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT3952_05_P1 3952 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, R41K, L63S, I64V, E65D, I72V, V77I  
>3952| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QISVDICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67DG Y181C   I31L, V35T, T39I, E40D, V60I, D121Y, K122E, S162A, D177E, Q207E, R211K, L228LR  
>3952| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICIDMEKEGKISKIGPENPYNTPI
FAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010