<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT3548_05_P1 3548 Uganda 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 34
2 D4T+3TC+ABC 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, M184V       V35T, E36A, T39E, E40D, S48T, E53D, V118I, K122E, K173A, Q174K, T200A, Q207N, R211K, F214L, L228Q  
>3548| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGLTTPDKKHQKEPPFQWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, Q61E, L63P, H69K, V82VI, L89M, I93L  
>3548| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010