<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT2295_05_P1 2295 Uganda 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       V35T, S48T, V60I, E79EQ, K122E, D123G, K173A, Q174K, D177E, Q197P, T200A, E203K, Q207E, R211K  
>2295| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRQLNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGPHRAKIKELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, I15V, K20R, M36I, R41K, I62V, L63P, H69K, L89M, I93L  
>2295| codons 1-99
PQITLWQRPLVAVKVGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010