<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT0925_05_P1 925 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, E34EK, E35D, N37S, R41K, I64V, V77I  
>925| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLKDMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       V35T, T39M, K49R, E53D, V60I, D121Y, K122E, D177E, I178M, T200K, E203K, E204D, Q207E, R211K  
>925| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPDNPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRKKIKDLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010