<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16735D_P1 16735 Uganda 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 4
2 D4T+3TC+ABC 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184V V75I, F116Y     V35T, K43R, V60I, S68G, D121H, K122E, K173S, Q174K, D177E, I178M, T200M, Q207E, R211K, F214L  
>16735| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKRKDGTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRSKNPEMVI
YQYVDDLYVGSDLEIGQHRMKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, I64IM, H69K, L89M  
>16735| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010