<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16666D_P1 16666 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, L33V, R41K, L63P, I64V  
>16666| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V       E6G, I31L, V35T, E36D, K43R, V60I, K122E, I135T, I142M, S162H, F171L, I178M, T200M, Q207E, R211K L205S
>16666| codons 1-242
PISPIGTVPVKLKPGMDGPKVKQWPLTEEKLKALTDICTEMEREGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQHSMTKILEPLRKQNPDMVI
YQYVDDLYVGSDLEIGQHRMKIEESREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010