<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
194.793 BPG194-793 Uganda 1994 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, E35D, M36I, R41K, R57K, L63I, H69K, L89M  
>BPG194-793| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6N, V35T, V60I, K122E, D123S, I135T, T139M, S162Y, K173L, Q174K, D177E, V179I, Q207E, R211S, V245Q, D250E, T286A, E291D, V292I, I293V, L295M, E312D  
>BPG194-793| codons 1-314
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELREHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPMTEEAE
LELAENREILKDPV

References
Author Title Citation
Becker-Pergola, G Analysis of HIV type 1 protease and reverse transcriptase in antiretroviral drug naive Ugandan adults. ARHR, 2000