<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
15213D_P1 15213 Uganda 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6D, V35T, E36A, T39K, S48T, V118I, K122E, D123N, K173A, Q174K, D177E, I178V, Q197K, T200A, Q207E, F214L, L228M K30N
>15213| codons 1-242
PISPIDTVPVKLKPGMDGPKVKQWPLTEENIKALTAICKEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEVVI
YQYVDDLYVGSDLEIGKHRAKIEELREHLLRWGLTTPDKKHQKEPPFMWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, N37K, R41S, L63V, H69K, L89M  
>15213| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEIKLPGSWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010