<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14188D_P1 14188 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215N G190A, M230L   V21I, V35T, E44D, V60I, K122E, D123E, D177E, I178M, G196E, T200I, Q207G, R211K  
>14188| codons 1-242
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKDGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVASDLEIEQHRIKIEELRGHLLKWGFNTPDKKHQKEPPFLWLGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20KR, E35D, M36I, R41K, R57K, I62V, L63S, H69K, L89M  
>14188| codons 1-99
PQITLWQRPIVTVRIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVSIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010