<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
151.940 BPG151-940 Uganda 1994 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13V, I15V, L19I, R41K, V77I  
>BPG151-940| codons 1-99
PQITLWQRPLVKVKVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, E40D, K49R, V60I, D121Y, K122E, D123E, I159V, D177E, I178M, T200I, Q207G, R211K, V245K, D250E, A272P, L282C, L283I, R284K, I293V, L310Q  
>BPG151-940| codons 1-321
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIKGTKALTEVVPLTEEAE
LELAENREIQKEPVHGVYYDP

References
Author Title Citation
Becker-Pergola, G Analysis of HIV type 1 protease and reverse transcriptase in antiretroviral drug naive Ugandan adults. ARHR, 2000