<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13765D_P1 13765 Uganda 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, M36I, L63V, I64V, H69K  
>13765| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIVVEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, V60I, D121Y, K122E, D123E, I135T, S162C, D177E, T200A, Q207E, R211K  
>13765| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010