<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13325D_P1rt 13325 Uganda 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+ABC 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       V35T, T39M, K49R, V60I, K122E, D123S, I135T, S162N, K173S, Q174K, D177E, V179I, T200A, Q207E  
>13325| codons 8-242
VPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPIFAIKKKD
STRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKY
TAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIIIYQYVDDL
YVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010